Lineage for d5zh0a_ (5zh0 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2389728Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2389773Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2389847Species Hypocrea jecorina [TaxId:1344414] [365691] (8 PDB entries)
  8. 2389848Domain d5zh0a_: 5zh0 A: [366328]
    automated match to d4xqdb_
    complexed with gol, iod

Details for d5zh0a_

PDB Entry: 5zh0 (more details), 1.08 Å

PDB Description: crystal structures of endo-beta-1,4-xylanase ii
PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d5zh0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zh0a_ b.29.1.11 (A:) Xylanase II {Hypocrea jecorina [TaxId: 1344414]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs

SCOPe Domain Coordinates for d5zh0a_:

Click to download the PDB-style file with coordinates for d5zh0a_.
(The format of our PDB-style files is described here.)

Timeline for d5zh0a_: