Lineage for d5zg8a1 (5zg8 A:1-100)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400310Species Thermus thermophilus [TaxId:274] [366304] (1 PDB entry)
  8. 2400311Domain d5zg8a1: 5zg8 A:1-100 [366305]
    Other proteins in same PDB: d5zg8a2
    automated match to d1x54a1

Details for d5zg8a1

PDB Entry: 5zg8 (more details), 2.4 Å

PDB Description: crystal structure of ttnrs
PDB Compounds: (A:) Asparagine--tRNA ligase

SCOPe Domain Sequences for d5zg8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zg8a1 b.40.4.0 (A:1-100) automated matches {Thermus thermophilus [TaxId: 274]}
mrvfideiarhvdqevelrgwlyqrrskgkihflilrdgtgflqatvvqgevpeavfrea
dhlpqetalrvwgrvredrrapggfelavrdlqvvsrpqg

SCOPe Domain Coordinates for d5zg8a1:

Click to download the PDB-style file with coordinates for d5zg8a1.
(The format of our PDB-style files is described here.)

Timeline for d5zg8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zg8a2