Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [366304] (1 PDB entry) |
Domain d5zg8a1: 5zg8 A:1-100 [366305] Other proteins in same PDB: d5zg8a2 automated match to d1x54a1 |
PDB Entry: 5zg8 (more details), 2.4 Å
SCOPe Domain Sequences for d5zg8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zg8a1 b.40.4.0 (A:1-100) automated matches {Thermus thermophilus [TaxId: 274]} mrvfideiarhvdqevelrgwlyqrrskgkihflilrdgtgflqatvvqgevpeavfrea dhlpqetalrvwgrvredrrapggfelavrdlqvvsrpqg
Timeline for d5zg8a1: