![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) ![]() automatically mapped to Pfam PF02285 |
![]() | Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81428] (32 PDB entries) |
![]() | Domain d6nmpz_: 6nmp Z: [366235] Other proteins in same PDB: d6nmpa_, d6nmpb1, d6nmpb2, d6nmpc_, d6nmpd_, d6nmpe_, d6nmpf_, d6nmpg_, d6nmph_, d6nmpi_, d6nmpj_, d6nmpk_, d6nmpl_, d6nmpn_, d6nmpo1, d6nmpo2, d6nmpp_, d6nmpq_, d6nmpr_, d6nmps_, d6nmpt_, d6nmpu_, d6nmpv_, d6nmpw_, d6nmpx_, d6nmpy_ automated match to d1v54m_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn |
PDB Entry: 6nmp (more details), 2.9 Å
SCOPe Domain Sequences for d6nmpz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nmpz_ f.23.7.1 (Z:) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]} itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
Timeline for d6nmpz_:
![]() Domains from other chains: (mouse over for more information) d6nmpa_, d6nmpb1, d6nmpb2, d6nmpc_, d6nmpd_, d6nmpe_, d6nmpf_, d6nmpg_, d6nmph_, d6nmpi_, d6nmpj_, d6nmpk_, d6nmpl_, d6nmpm_, d6nmpn_, d6nmpo1, d6nmpo2, d6nmpp_, d6nmpq_, d6nmpr_, d6nmps_, d6nmpt_, d6nmpu_, d6nmpv_, d6nmpw_, d6nmpx_, d6nmpy_ |