SCOPe 2.08: Domain d6nmpx_: 6nmp X:

Lineage for d6nmpx_ (6nmp X:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family)
   automatically mapped to Pfam PF05392

5. Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81420] (33 PDB entries)

8. Domain d6nmpx_: 6nmp X: [366229]
   Other proteins in same PDB: d6nmpa_, d6nmpb1, d6nmpb2, d6nmpc_, d6nmpd_, d6nmpe_, d6nmpf_, d6nmpg_, d6nmph_, d6nmpi_, d6nmpj_, d6nmpl_, d6nmpm_, d6nmpn_, d6nmpo1, d6nmpo2, d6nmpp_, d6nmpq_, d6nmpr_, d6nmps_, d6nmpt_, d6nmpu_, d6nmpv_, d6nmpw_, d6nmpy_, d6nmpz_
   automated match to d1v54k_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d6nmpx_

PDB Entry: 6nmp, 2.9 Å

PDB Description: sfx structure of oxidized cytochrome c oxidase at room temperature

PDB Compounds: (X:) cytochrome c oxidase subunit 7b, mitochondrial

SCOPe Domain Sequences for d6nmpx_:

Sequence; same for both SEQRES and ATOM records:

>d6nmpx_ f.23.5.1 (X:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

Timeline for d6nmpx_:

• d6nmpx_ first appeared in SCOPe 2.07