Lineage for d6nmfw_ (6nmf W:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025133Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
    automatically mapped to Pfam PF02238
  5. 3025134Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins)
  6. 3025135Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3025136Species Cow (Bos taurus) [TaxId:9913] [81416] (56 PDB entries)
  8. 3025238Domain d6nmfw_: 6nmf W: [366227]
    Other proteins in same PDB: d6nmfa_, d6nmfb1, d6nmfb2, d6nmfc_, d6nmfd_, d6nmfe_, d6nmff_, d6nmfg_, d6nmfh_, d6nmfi_, d6nmfk_, d6nmfl_, d6nmfm_, d6nmfn_, d6nmfo1, d6nmfo2, d6nmfp_, d6nmfq_, d6nmfr_, d6nmfs_, d6nmft_, d6nmfu_, d6nmfv_, d6nmfx_, d6nmfy_, d6nmfz_
    automated match to d1v54j_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d6nmfw_

PDB Entry: 6nmf (more details), 2.8 Å

PDB Description: sfx structure of reduced cytochrome c oxidase at room temperature
PDB Compounds: (W:) cytochrome c oxidase subunit 7a1, mitochondrial

SCOPe Domain Sequences for d6nmfw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nmfw_ f.23.4.1 (W:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

SCOPe Domain Coordinates for d6nmfw_:

Click to download the PDB-style file with coordinates for d6nmfw_.
(The format of our PDB-style files is described here.)

Timeline for d6nmfw_: