Lineage for d6m9xd_ (6m9x D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2547743Species Branchiostoma floridae [TaxId:7739] [226665] (5 PDB entries)
  8. 2547759Domain d6m9xd_: 6m9x D: [366032]
    automated match to d5ltqe_

Details for d6m9xd_

PDB Entry: 6m9x (more details), 1.81 Å

PDB Description: x-ray structure of branchiostoma floridae fluorescent protein lanfp10a
PDB Compounds: (D:) Fluorescent protein lanFP10A

SCOPe Domain Sequences for d6m9xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m9xd_ d.22.1.0 (D:) automated matches {Branchiostoma floridae [TaxId: 7739]}
plpkthelhifgsfngvefdmvgrgignpnegseelnakftkgplkfspyilvphlxyyq
ylpfpdgmspfqaamhdgsgyqvhrtiqyedgasvtahyrytyegshikgefqvigtgfp
pdgpvmtnkltamdwsvtkmlypndktilstadcsytttagkryqskmrenntfakpmaa
dilqkqpmfvfrkselqhskteltfkewqkaftdvm

SCOPe Domain Coordinates for d6m9xd_:

Click to download the PDB-style file with coordinates for d6m9xd_.
(The format of our PDB-style files is described here.)

Timeline for d6m9xd_: