SCOPe 2.07: Domain d6iybb1: 6iyb B:5-138

Lineage for d6iybb1 (6iyb B:5-138)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.0: automated matches [191667] (1 protein)
   not a true family

6. Protein automated matches [191267] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189837] (21 PDB entries)

8. Domain d6iybb1: 6iyb B:5-138 [366011]
   Other proteins in same PDB: d6iyba_, d6iybb2, d6iybc_, d6iybd2
   automated match to d2kxpc_
   complexed with gtp, mg

Details for d6iybb1

PDB Entry: 6iyb, 2.09 Å

PDB Description: structure of human orp1 ank - rab7 complex

PDB Compounds: (B:) Oxysterol-binding protein-related protein 1

SCOPe Domain Sequences for d6iybb1:

Sequence; same for both SEQRES and ATOM records:

>d6iybb1 d.211.1.0 (B:5-138) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeqqllhharngnaeevrqlletmarneviadinckgrsksnlgwtplhlacyfghrqvv
qdllkagaevnvlndmgdtplhraaftgrkelvmllleynadttivngsgqtakevthae
eirsmleavertqq

Timeline for d6iybb1:

• d6iybb1 is new in SCOPe 2.07-stable
  
• d6iybb1 appears in the current release, SCOPe 2.08