Lineage for d6h2ma_ (6h2m A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2387950Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2387954Protein Concanavalin A [49901] (4 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 2387977Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (73 PDB entries)
    Uniprot P81461
  8. 2388041Domain d6h2ma_: 6h2m A: [365827]
    automated match to d1nlsa_
    complexed with ca, mn

Details for d6h2ma_

PDB Entry: 6h2m (more details), 1.93 Å

PDB Description: long wavelength mesh&collect native sad phasing on microcrystals
PDB Compounds: (A:) Concanavalin-A,Concanavalin-A

SCOPe Domain Sequences for d6h2ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h2ma_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d6h2ma_:

Click to download the PDB-style file with coordinates for d6h2ma_.
(The format of our PDB-style files is described here.)

Timeline for d6h2ma_: