Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
Protein automated matches [226887] (24 species) not a true protein |
Species Plasmodium falciparum [TaxId:5843] [354075] (9 PDB entries) |
Domain d6agtb2: 6agt B:229-583 [365731] Other proteins in same PDB: d6agta1, d6agtb1, d6agtc1, d6agtd1 automated match to d3bjua2 complexed with 9x0, co, fmt, lys, mla |
PDB Entry: 6agt (more details), 1.95 Å
SCOPe Domain Sequences for d6agtb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6agtb2 d.104.1.0 (B:229-583) automated matches {Plasmodium falciparum [TaxId: 5843]} dteiryrqryldllinessrhtfvtrtkiinflrnflnergffevetpmmnliagganar pfithhndldldlylriatelplkmlivggidkvyeigkvfrnegidnthnpeftscefy wayadyndlikwsedffsqlvyhlfgtykisynkdgpenqpieidftppypkvsiveeie kvtntileqpfdsnetiekminiikehkielpnpptaaklldqlashfienkyndkpffi vehpqimsplakyhrtkpglterlemficgkevlnaytelndpfkqkecfklqqkdrekg dteaaqldsafctsleyglpptgglglgidritmfltnknsikdvilfptmrpan
Timeline for d6agtb2: