Lineage for d2xsra1 (2xsr A:2-306)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2379685Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2380104Family b.3.6.0: automated matches [227249] (1 protein)
    not a true family
  6. 2380105Protein automated matches [227026] (6 species)
    not a true protein
  7. 2380106Species Acinetobacter radioresistens [TaxId:40216] [365681] (1 PDB entry)
  8. 2380107Domain d2xsra1: 2xsr A:2-306 [365682]
    Other proteins in same PDB: d2xsra2
    automated match to d2azqa_
    complexed with fe, pie

Details for d2xsra1

PDB Entry: 2xsr (more details), 1.8 Å

PDB Description: crystal structure of wild type acinetobacter radioresistens catechol 1,2 dioxygenase
PDB Compounds: (A:) catechol 1,2 dioxygenase

SCOPe Domain Sequences for d2xsra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xsra1 b.3.6.0 (A:2-306) automated matches {Acinetobacter radioresistens [TaxId: 40216]}
nrqqidalvkqmnvdtakgpvderiqqvvvrllgdlfqaiedldiqpsevwkgleyltda
gqanelgllaaglglehyldlradeadakagitggtprtiegplyvagapesvgfarmdd
gsesdkvdtliiegtvtdtegniiegakvevwhanslgnysffdksqsdfnlrrtiltdv
ngkyvalttmpvgygcppegttqallnklgrhgnrpshvhyfvsapgyrklttqfniegd
eylwddfafatrdglvatatdvtdeaeiarreldkpfkhitfnvelvkeaeaapssever
rrasa

SCOPe Domain Coordinates for d2xsra1:

Click to download the PDB-style file with coordinates for d2xsra1.
(The format of our PDB-style files is described here.)

Timeline for d2xsra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xsra2