Lineage for d6nruh_ (6nru H:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498790Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2498791Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2499039Family c.60.1.0: automated matches [196988] (1 protein)
    not a true family
  6. 2499040Protein automated matches [196989] (15 species)
    not a true protein
  7. 2499098Species Shigella flexneri [TaxId:42897] [365654] (1 PDB entry)
  8. 2499106Domain d6nruh_: 6nru H: [365670]
    automated match to d4ij6b_
    complexed with cl, edo, gol, peg, pg4, so4

Details for d6nruh_

PDB Entry: 6nru (more details), 2.51 Å

PDB Description: crystal structure of the alpha-ribazole phosphatase from shigella flexneri
PDB Compounds: (H:) CobC

SCOPe Domain Sequences for d6nruh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nruh_ c.60.1.0 (H:) automated matches {Shigella flexneri [TaxId: 42897]}
mrlwlirhgetqanvdglysghaptpltargieqaqnlhtllddvsfdlvlcseleraqh
tarlvlsdrqlpvhiipelnemffgdwemrhhrdlmqedaenysawcndwqhaiptngeg
fqafsqrverfiarlseyqhyqnilivshqgvlslliarligmpaesmwhfrvdqgcwsa
idinqkfatlrvlnsraigven

SCOPe Domain Coordinates for d6nruh_:

Click to download the PDB-style file with coordinates for d6nruh_.
(The format of our PDB-style files is described here.)

Timeline for d6nruh_: