Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) |
Family c.60.1.0: automated matches [196988] (1 protein) not a true family |
Protein automated matches [196989] (15 species) not a true protein |
Species Shigella flexneri [TaxId:42897] [365654] (1 PDB entry) |
Domain d6nruh_: 6nru H: [365670] automated match to d4ij6b_ complexed with cl, edo, gol, peg, pg4, so4 |
PDB Entry: 6nru (more details), 2.51 Å
SCOPe Domain Sequences for d6nruh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nruh_ c.60.1.0 (H:) automated matches {Shigella flexneri [TaxId: 42897]} mrlwlirhgetqanvdglysghaptpltargieqaqnlhtllddvsfdlvlcseleraqh tarlvlsdrqlpvhiipelnemffgdwemrhhrdlmqedaenysawcndwqhaiptngeg fqafsqrverfiarlseyqhyqnilivshqgvlslliarligmpaesmwhfrvdqgcwsa idinqkfatlrvlnsraigven
Timeline for d6nruh_: