SCOPe 2.07: Domain d6j47o_: 6j47 O:

Lineage for d6j47o_ (6j47 O:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
   single sheet formed by beta-hairpin repeats; exposed on both sides in the middle

4. Superfamily b.76.1: Outer surface protein [51087] (1 family)
   21 stranded sheet partly folded upon itself at the ends

5. Family b.76.1.1: Outer surface protein [51088] (3 proteins)

6. Protein automated matches [190440] (3 species)
   not a true protein

7. Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [188450] (25 PDB entries)

8. Domain d6j47o_: 6j47 O: [365618]
   automated match to d3aumo_
   complexed with pg4, trs

Details for d6j47o_

PDB Entry: 6j47, 1.9 Å

PDB Description: ospa variant with a short chameleon sequence from alpha b crystallin

PDB Compounds: (O:) Outer surface protein A

SCOPe Domain Sequences for d6j47o_:

Sequence; same for both SEQRES and ATOM records:

>d6j47o_ b.76.1.1 (O:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
nsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkadaskvk
ltisddlgqttlevfksdgstlvskkvtskdkvlgdvkfnekgevsekiitradgtrley
tgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgavsvelndtdss
aatkktaawnsgtstltitvnskktkdlvftssntitvqqydsngtslegsaveitklde
iknalk

Timeline for d6j47o_:

• d6j47o_ is new in SCOPe 2.07-stable
  
• d6j47o_ appears in the current release, SCOPe 2.08