Class b: All beta proteins [48724] (178 folds) |
Fold b.76: open-sided beta-meander [51086] (2 superfamilies) single sheet formed by beta-hairpin repeats; exposed on both sides in the middle |
Superfamily b.76.1: Outer surface protein [51087] (1 family) 21 stranded sheet partly folded upon itself at the ends |
Family b.76.1.1: Outer surface protein [51088] (3 proteins) |
Protein automated matches [190440] (3 species) not a true protein |
Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [188450] (25 PDB entries) |
Domain d6j47o_: 6j47 O: [365618] automated match to d3aumo_ complexed with pg4, trs |
PDB Entry: 6j47 (more details), 1.9 Å
SCOPe Domain Sequences for d6j47o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j47o_ b.76.1.1 (O:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} nsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkadaskvk ltisddlgqttlevfksdgstlvskkvtskdkvlgdvkfnekgevsekiitradgtrley tgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgavsvelndtdss aatkktaawnsgtstltitvnskktkdlvftssntitvqqydsngtslegsaveitklde iknalk
Timeline for d6j47o_: