Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.6: omega toxin-like [57059] (5 families) |
Family g.3.6.2: Spider toxins [57072] (26 proteins) |
Protein automated matches [254476] (10 species) not a true protein |
Species Cyriopagopus schioedtei [TaxId:1046902] [365614] (1 PDB entry) |
Domain d6gfta_: 6gft A: [365615] automated match to d1nixa_ |
PDB Entry: 6gft (more details)
SCOPe Domain Sequences for d6gfta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gfta_ g.3.6.2 (A:) automated matches {Cyriopagopus schioedtei [TaxId: 1046902]} eckgfgkscvpgkneccsgltcsnkhkwckvll
Timeline for d6gfta_: