Lineage for d6gfta_ (6gft A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635040Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. 2635081Family g.3.6.2: Spider toxins [57072] (26 proteins)
  6. 2635170Protein automated matches [254476] (10 species)
    not a true protein
  7. 2635173Species Cyriopagopus schioedtei [TaxId:1046902] [365614] (1 PDB entry)
  8. 2635174Domain d6gfta_: 6gft A: [365615]
    automated match to d1nixa_

Details for d6gfta_

PDB Entry: 6gft (more details)

PDB Description: antinociceptive evaluation of cyriotoxin-1a, the first toxin purified from cyriopagopus schioedtei spider venom
PDB Compounds: (A:) cyriotoxin-1a

SCOPe Domain Sequences for d6gfta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gfta_ g.3.6.2 (A:) automated matches {Cyriopagopus schioedtei [TaxId: 1046902]}
eckgfgkscvpgkneccsgltcsnkhkwckvll

SCOPe Domain Coordinates for d6gfta_:

Click to download the PDB-style file with coordinates for d6gfta_.
(The format of our PDB-style files is described here.)

Timeline for d6gfta_: