Lineage for d6q93d_ (6q93 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2477146Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2477447Protein automated matches [190304] (16 species)
    not a true protein
  7. 2477448Species Azotobacter vinelandii [TaxId:322710] [365462] (1 PDB entry)
  8. 2477452Domain d6q93d_: 6q93 D: [365524]
    automated match to d2afhe_
    complexed with adp, mg, sf4

Details for d6q93d_

PDB Entry: 6q93 (more details), 2.2 Å

PDB Description: mgadp-bound fe protein of vanadium nitrogenase from azotobacter vinelandii
PDB Compounds: (D:) nitrogenase iron protein

SCOPe Domain Sequences for d6q93d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q93d_ c.37.1.10 (D:) automated matches {Azotobacter vinelandii [TaxId: 322710]}
alrqcaiygkggigkstttqnlvaalaeagkkvmivgcdpkadstrlilhskaqgtvmem
aasagsvedleledvlqigfggvkcvesggpepgvgcagrgvitainfleeegaysddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniakgivkyahsgsvrlg
glicnsrktdredelimalaakigtqmihfvprdnvvqhaeirrmtvieydpkagqadey
ralarkivdnkllvipnpasmeeleellmefg

SCOPe Domain Coordinates for d6q93d_:

Click to download the PDB-style file with coordinates for d6q93d_.
(The format of our PDB-style files is described here.)

Timeline for d6q93d_: