Lineage for d6ialj_ (6ial J:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2397831Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2398006Protein Heat-labile toxin [50205] (2 species)
  7. 2398007Species Escherichia coli, type IB [TaxId:562] [50206] (23 PDB entries)
  8. 2398052Domain d6ialj_: 6ial J: [365424]
    automated match to d1djrd_
    complexed with bgc, ca, gal, gol, na, nag

Details for d6ialj_

PDB Entry: 6ial (more details), 1.45 Å

PDB Description: porcine e.coli heat-labile enterotoxin b-pentamer in complex with lacto-n-neohexaose
PDB Compounds: (J:) heat-labile enterotoxin b chain

SCOPe Domain Sequences for d6ialj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ialj_ b.40.2.1 (J:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOPe Domain Coordinates for d6ialj_:

Click to download the PDB-style file with coordinates for d6ialj_.
(The format of our PDB-style files is described here.)

Timeline for d6ialj_: