Class b: All beta proteins [48724] (178 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (4 families) duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core |
Family b.85.7.0: automated matches [227191] (1 protein) not a true family |
Protein automated matches [226914] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225158] (28 PDB entries) |
Domain d6mbob_: 6mbo B: [365415] automated match to d5ttga_ complexed with edo, jdg, sah, zn |
PDB Entry: 6mbo (more details), 1.59 Å
SCOPe Domain Sequences for d6mbob_:
Sequence, based on SEQRES records: (download)
>d6mbob_ b.85.7.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} erivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvcid dcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglra rlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldnkdgevyc idarfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdygerf wdikgklfscrcgspkcrhs
>d6mbob_ b.85.7.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} erivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvcid dcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglra rlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldngevycid arfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdygerfwd ikgklfscrcgspkcrhs
Timeline for d6mbob_: