Lineage for d6e3bn_ (6e3b N:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483040Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2483041Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2483042Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 2483100Protein automated matches [190696] (5 species)
    not a true protein
  7. 2483155Species Saccharomyces cerevisiae [TaxId:4932] [365254] (1 PDB entry)
  8. 2483169Domain d6e3bn_: 6e3b N: [365303]
    automated match to d1xria_
    complexed with so4

Details for d6e3bn_

PDB Entry: 6e3b (more details), 2.5 Å

PDB Description: structure of siw14 catalytic core
PDB Compounds: (N:) Tyrosine-protein phosphatase SIW14

SCOPe Domain Sequences for d6e3bn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e3bn_ c.45.1.1 (N:) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
nkevippenfshvvgeiyrssfprqenfsflherlklksilvlipeeypqenlnflkltg
iklyqvgmsgnkepfvnipshlltkaleivlnpanqpilihsnrgkhrtgcligcirklq
nwsltmifdeyrrfafpkaraldqqfiemydddeikriasknnwlplqw

SCOPe Domain Coordinates for d6e3bn_:

Click to download the PDB-style file with coordinates for d6e3bn_.
(The format of our PDB-style files is described here.)

Timeline for d6e3bn_: