SCOPe 2.07: Domain d6gals_: 6gal S:

Lineage for d6gals_ (6gal S:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.0: automated matches [191636] (1 protein)
   not a true family

6. Protein automated matches [191172] (11 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [351202] (9 PDB entries)

8. Domain d6gals_: 6gal S: [365287]
   Other proteins in same PDB: d6gall_, d6galm_
   automated match to d3rgws_
   complexed with cl, cxs, ej2, f3s, li, mg, sf3, sf4, so4

Details for d6gals_

PDB Entry: 6gal, 1.25 Å

PDB Description: structure of fully reduced hydrogenase (hyd-1) variant e28q collected at ph 10

PDB Compounds: (S:) Hydrogenase-1 small chain

SCOPe Domain Sequences for d6gals_:

Sequence; same for both SEQRES and ATOM records:

>d6gals_ e.19.1.0 (S:) automated matches {Escherichia coli [TaxId: 83333]}
kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
qsghgclgcaengfwdrgsfysrv

Timeline for d6gals_:

• d6gals_ is new in SCOPe 2.07-stable
  
• d6gals_ appears in the current release, SCOPe 2.08