Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein automated matches [190101] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries) |
Domain d6ghmd1: 6ghm D:920-1055 [365279] Other proteins in same PDB: d6ghmc2, d6ghmd2 automated match to d4a63d1 complexed with edo, gol, mn, nhe |
PDB Entry: 6ghm (more details), 2.15 Å
SCOPe Domain Sequences for d6ghmd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ghmd1 d.211.1.1 (D:920-1055) automated matches {Human (Homo sapiens) [TaxId: 9606]} mrvkfnplallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflv qfgvnvnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeeg ytqcsqflygvqekmg
Timeline for d6ghmd1: