SCOPe 2.07: Domain d6mhcb1: 6mhc B:1-102

Lineage for d6mhcb1 (6mhc B:1-102)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class omega GST [81363] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52877] (17 PDB entries)

8. Domain d6mhcb1: 6mhc B:1-102 [365139]
   Other proteins in same PDB: d6mhca2, d6mhca3, d6mhcb2, d6mhcb3
   automated match to d1eema2
   complexed with dms, jrm, mes, peg

Details for d6mhcb1

PDB Entry: 6mhc, 2 Å

PDB Description: glutathione s-transferase omega 1 bound to covalent inhibitor 37

PDB Compounds: (B:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d6mhcb1:

Sequence; same for both SEQRES and ATOM records:

>d6mhcb1 c.47.1.5 (B:1-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
msgesarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkp
ewffkknpfglvpvlensqgqliyesaitceyldeaypgkkl

Timeline for d6mhcb1:

• d6mhcb1 is new in SCOPe 2.07-stable
  
• d6mhcb1 appears in the current release, SCOPe 2.08