Lineage for d1gbza_ (1gbz A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1397247Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1397248Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1397278Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1397338Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1397883Species Human (Homo sapiens) [TaxId:9606] [53969] (200 PDB entries)
    Uniprot P00695
  8. 1397982Domain d1gbza_: 1gbz A: [36499]
    complexed with na; mutant

Details for d1gbza_

PDB Entry: 1gbz (more details), 1.8 Å

PDB Description: crystal structure of mutant human lysozyme substituted at the surface positions
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1gbza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gbza_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawfawrnrcqnrd
vrqyvqgcgv

SCOPe Domain Coordinates for d1gbza_:

Click to download the PDB-style file with coordinates for d1gbza_.
(The format of our PDB-style files is described here.)

Timeline for d1gbza_: