Lineage for d6iw2d1 (6iw2 D:1-295)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2628446Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2628447Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2628492Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 2628493Protein automated matches [227047] (11 species)
    not a true protein
  7. 2628519Species Yellow fever virus (strain 17d vaccine) [TaxId:11090] [364871] (3 PDB entries)
  8. 2628523Domain d6iw2d1: 6iw2 D:1-295 [364982]
    Other proteins in same PDB: d6iw2a2, d6iw2b_, d6iw2c_, d6iw2d2, d6iw2e_, d6iw2f_, d6iw2g2, d6iw2h_, d6iw2i_, d6iw2j2, d6iw2k_, d6iw2l_, d6iw2m2, d6iw2n_, d6iw2o_, d6iw2p2, d6iw2q_, d6iw2r_
    automated match to d3p54a1

Details for d6iw2d1

PDB Entry: 6iw2 (more details), 2.9 Å

PDB Description: crystal structure of 5a scfv in complex with yfv-17d se in prefusion state
PDB Compounds: (D:) Envelope protein E

SCOPe Domain Sequences for d6iw2d1:

Sequence, based on SEQRES records: (download)

>d6iw2d1 f.10.1.0 (D:1-295) automated matches {Yellow fever virus (strain 17d vaccine) [TaxId: 11090]}
ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidrpaevrkvc
ynavlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakft
caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqevefigygkatl
ecqvqtavdfgnsyiaemeteswivdrqwaqdltlpwqsgsggvwremhhlvefepphaa
tirvlalgnqegslktaltgamrvtkdtndnnlyklhgghvscrvklsaltlkgt

Sequence, based on observed residues (ATOM records): (download)

>d6iw2d1 f.10.1.0 (D:1-295) automated matches {Yellow fever virus (strain 17d vaccine) [TaxId: 11090]}
ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidrpaevrkvc
ynavlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakft
caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqevefigygkatl
ecqvqtavdfgnsyiaemeteswivdrqwaqdltlpwqsgsggvwremhhlvefepphaa
tirvlalgnqegslktaltgamrvtkdtlyklhgghvscrvklsaltlkgt

SCOPe Domain Coordinates for d6iw2d1:

Click to download the PDB-style file with coordinates for d6iw2d1.
(The format of our PDB-style files is described here.)

Timeline for d6iw2d1: