SCOPe 2.07: Domain d6iw1a2: 6iw1 A:296-392

Lineage for d6iw1a2 (6iw1 A:296-392)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Yellow fever virus (strain 17d vaccine) [TaxId:11090] [364873] (3 PDB entries)

8. Domain d6iw1a2: 6iw1 A:296-392 [364980]
   Other proteins in same PDB: d6iw1a1, d6iw1b1, d6iw1c1
   automated match to d3p54a2

Details for d6iw1a2

PDB Entry: 6iw1, 3.1 Å

PDB Description: crystal structure of yfv-17d se in postfusion state

PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d6iw1a2:

Sequence, based on SEQRES records:

>d6iw1a2 b.1.18.0 (A:296-392) automated matches {Yellow fever virus (strain 17d vaccine) [TaxId: 11090]}
sykictdkmffvknptdtghgtvvmqvkvskgapcripvivaddltaainkgilvtvnpi
astnddevlievnppfgdsyiivgrgdsrltyqwhke

Sequence, based on observed residues (ATOM records):

>d6iw1a2 b.1.18.0 (A:296-392) automated matches {Yellow fever virus (strain 17d vaccine) [TaxId: 11090]}
sykictdkmffvknptdtghgtvvmqvkvskgapcripvivadaainkgilvtvnpiast
nddevlievnppfgdsyiivgrgdsrltyqwhke

Timeline for d6iw1a2:

• d6iw1a2 is new in SCOPe 2.07-stable
  
• d6iw1a2 appears in the current release, SCOPe 2.08