Lineage for d6iw5b1 (6iw5 B:1-295)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576583Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2576584Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2576629Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 2576630Protein automated matches [227047] (10 species)
    not a true protein
  7. 3059469Species Yellow fever virus [TaxId:11089] [359531] (3 PDB entries)
  8. 3064780Domain d6iw5b1: 6iw5 B:1-295 [364842]
    Other proteins in same PDB: d6iw5a2, d6iw5b2, d6iw5c2, d6iw5d2
    automated match to d3p54a1

Details for d6iw5b1

PDB Entry: 6iw5 (more details), 2.5 Å

PDB Description: crystal structure of yfv-china se in prefusion state
PDB Compounds: (B:) envelope protein

SCOPe Domain Sequences for d6iw5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iw5b1 f.10.1.0 (B:1-295) automated matches {Yellow fever virus [TaxId: 11089]}
ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldislqtvaidgpaearkvc
ysavlthvkindkcpstgeahlaeendgdnackrtysdrgwgngcglfgkgsivacakft
caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatl
ecqvqtavdfgnsyiaemekdswivdrqwaqdltlpwqsgsggiwremhhlvefepphaa
tirvlalgnqegslktaltgamrvtkdendnnlyklhgghvscrvklsaltlkgt

SCOPe Domain Coordinates for d6iw5b1:

Click to download the PDB-style file with coordinates for d6iw5b1.
(The format of our PDB-style files is described here.)

Timeline for d6iw5b1:

  • d6iw5b1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-14