Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (16 species) not a true protein |
Species Faecalibacterium prausnitzii [TaxId:411483] [364811] (1 PDB entry) |
Domain d6ed2a2: 6ed2 A:188-279 [364812] Other proteins in same PDB: d6ed2a1, d6ed2a3, d6ed2a4 automated match to d5c71a2 complexed with fmt, gol, mg |
PDB Entry: 6ed2 (more details), 2.3 Å
SCOPe Domain Sequences for d6ed2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ed2a2 b.1.4.0 (A:188-279) automated matches {Faecalibacterium prausnitzii [TaxId: 411483]} ervldystryrltetgaeidytvstngphpvtvelydgttrvaessgttgtlvvknarlw nvhaaylydlvirihegsavvdeyldrigirt
Timeline for d6ed2a2: