Lineage for d2xaub5 (2xau B:635-747)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400038Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225013] (3 PDB entries)
  8. 2400040Domain d2xaub5: 2xau B:635-747 [364734]
    Other proteins in same PDB: d2xaua1, d2xaua2, d2xaua3, d2xaua4, d2xaub1, d2xaub2, d2xaub3, d2xaub4
    automated match to d5jpta5
    protein/RNA complex; complexed with act, adp, gol, mg, ni

Details for d2xaub5

PDB Entry: 2xau (more details), 1.9 Å

PDB Description: crystal structure of the prp43p deah-box rna helicase in complex with adp
PDB Compounds: (B:) Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43

SCOPe Domain Sequences for d2xaub5:

Sequence, based on SEQRES records: (download)

>d2xaub5 b.40.4.0 (B:635-747) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nttdyespkyfdnirkalasgffmqvakkrsgakgyitvkdnqdvlihpstvlghdaewv
iynefvltsknyirtvtsvrpewlieiapayydlsnfqkgdvklslerikekv

Sequence, based on observed residues (ATOM records): (download)

>d2xaub5 b.40.4.0 (B:635-747) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nttdyespkyfdnirkalasgffmqvakkrgyitvkdnqdvlihpstvlghdaewviyne
fvltsknyirtvtsvrpewlieiapayydlsnfqkgdvklslerikekv

SCOPe Domain Coordinates for d2xaub5:

Click to download the PDB-style file with coordinates for d2xaub5.
(The format of our PDB-style files is described here.)

Timeline for d2xaub5: