Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225013] (3 PDB entries) |
Domain d2xaub5: 2xau B:635-747 [364734] Other proteins in same PDB: d2xaua1, d2xaua2, d2xaua3, d2xaua4, d2xaub1, d2xaub2, d2xaub3, d2xaub4 automated match to d5jpta5 protein/RNA complex; complexed with act, adp, gol, mg, ni |
PDB Entry: 2xau (more details), 1.9 Å
SCOPe Domain Sequences for d2xaub5:
Sequence, based on SEQRES records: (download)
>d2xaub5 b.40.4.0 (B:635-747) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nttdyespkyfdnirkalasgffmqvakkrsgakgyitvkdnqdvlihpstvlghdaewv iynefvltsknyirtvtsvrpewlieiapayydlsnfqkgdvklslerikekv
>d2xaub5 b.40.4.0 (B:635-747) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nttdyespkyfdnirkalasgffmqvakkrgyitvkdnqdvlihpstvlghdaewviyne fvltsknyirtvtsvrpewlieiapayydlsnfqkgdvklslerikekv
Timeline for d2xaub5: