SCOPe 2.08: Domain d6gqta1: 6gqt A:1-168

Lineage for d6gqta1 (6gqt A:1-168)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d6gqta1: 6gqt A:1-168 [364663]
   Other proteins in same PDB: d6gqta2, d6gqtb2, d6gqtc2, d6gqtd2, d6gqte2, d6gqtf2
   automated match to d4obea_
   complexed with cit, f8n, gnp, mg

Details for d6gqta1

PDB Entry: 6gqt, 1.69 Å

PDB Description: kras-169 q61h gppnhp + ppin-2

PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d6gqta1:

Sequence; same for both SEQRES and ATOM records:

>d6gqta1 c.37.1.8 (A:1-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

Timeline for d6gqta1:

• d6gqta1 first appeared in SCOPe 2.07