Lineage for d6j9se2 (6j9s E:151-317)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2604674Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2605180Protein automated matches [226882] (10 species)
    not a true protein
  7. 2605240Species Lactobacillus casei [TaxId:219334] [364536] (3 PDB entries)
  8. 2605245Domain d6j9se2: 6j9s E:151-317 [364592]
    Other proteins in same PDB: d6j9sa1, d6j9sb1, d6j9sc1, d6j9sd1, d6j9se1, d6j9sf1
    automated match to d1llca2
    complexed with gol, so4; mutant

Details for d6j9se2

PDB Entry: 6j9s (more details), 2 Å

PDB Description: penta mutant of lactobacillus casei lactate dehydrogenase
PDB Compounds: (E:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6j9se2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j9se2 d.162.1.1 (E:151-317) automated matches {Lactobacillus casei [TaxId: 219334]}
tsldtarfrqsiakmvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrnkayeiiklkgatfygiatalariskailndenavlplsvymdgqygl
ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdaf

SCOPe Domain Coordinates for d6j9se2:

Click to download the PDB-style file with coordinates for d6j9se2.
(The format of our PDB-style files is described here.)

Timeline for d6j9se2: