SCOPe 2.07: Domain d6gqyd1: 6gqy D:1-167

Lineage for d6gqyd1 (6gqy D:1-167)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (34 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (286 PDB entries)

8. Domain d6gqyd1: 6gqy D:1-167 [364496]
   Other proteins in same PDB: d6gqya2, d6gqyb2, d6gqyc2, d6gqyd2, d6gqye2, d6gqyf2
   automated match to d3gfta_
   complexed with f8q, gnp, mg

Details for d6gqyd1

PDB Entry: 6gqy, 2.75 Å

PDB Description: kras-169 q61h gppnhp + ch-3

PDB Compounds: (D:) GTPase KRas

SCOPe Domain Sequences for d6gqyd1:

Sequence, based on SEQRES records:

>d6gqyd1 c.37.1.8 (D:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Sequence, based on observed residues (ATOM records):

>d6gqyd1 c.37.1.8 (D:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
rdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdt
kqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Timeline for d6gqyd1:

• d6gqyd1 is new in SCOPe 2.07-stable
  
• d6gqyd1 appears in the current release, SCOPe 2.08