Lineage for d6elgb_ (6elg B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2309098Superfamily a.4.12: TrpR-like [48295] (4 families) (S)
    contains an extra shared helix after the HTH motif
  5. 2309099Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
    intertwined dimer of identical 6-helical subunits
    automatically mapped to Pfam PF01371
  6. 2309138Protein automated matches [254650] (4 species)
    not a true protein
  7. 2309155Species Escherichia coli [TaxId:83334] [340663] (10 PDB entries)
  8. 2309163Domain d6elgb_: 6elg B: [364472]
    automated match to d5tm0a_
    complexed with 3bo

Details for d6elgb_

PDB Entry: 6elg (more details), 1.38 Å

PDB Description: tryptophan repressor trpr from e.coli variant m42f t44l t81i s88y with indole-3-acetonitrile
PDB Compounds: (B:) trp operon repressor

SCOPe Domain Sequences for d6elgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6elgb_ a.4.12.1 (B:) automated matches {Escherichia coli [TaxId: 83334]}
qqspysaamaeqrhqewlrfvdllknayqndlhlpllnlfllpderealgtrvriveell
rgemsqrelknelgagiaiitrgsnylkaapvelrqwleevllk

SCOPe Domain Coordinates for d6elgb_:

Click to download the PDB-style file with coordinates for d6elgb_.
(The format of our PDB-style files is described here.)

Timeline for d6elgb_: