Lineage for d6admc_ (6adm C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822534Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2822535Protein automated matches [190988] (51 species)
    not a true protein
  7. 2822990Species Seneca valley virus [TaxId:390157] [188689] (3 PDB entries)
  8. 2822994Domain d6admc_: 6adm C: [364342]
    Other proteins in same PDB: d6admr1, d6admr2
    automated match to d3cjib_
    complexed with mg

Details for d6admc_

PDB Entry: 6adm (more details), 2.84 Å

PDB Description: anthrax toxin receptor 1-bound full particles of seneca valley virus in acidic conditions
PDB Compounds: (C:) vp3

SCOPe Domain Sequences for d6admc_:

Sequence, based on SEQRES records: (download)

>d6admc_ b.121.4.0 (C:) automated matches {Seneca valley virus [TaxId: 390157]}
piptaprenslmflstlpddtvpaygnvrtppvnylpgeitdllqlariptlmafervpe
pvpasdtyvpyvavptqfddrplisfpitlsdpvyqntlvgaissnfanyrgciqitltf
cgpmmargkfllsysppngtqpqtlseamqctysiwdiglnsswtfvvpyispsdyretr
aitnsvysadgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf

Sequence, based on observed residues (ATOM records): (download)

>d6admc_ b.121.4.0 (C:) automated matches {Seneca valley virus [TaxId: 390157]}
piptaprenslmflstlpddtvpaygnvrtppvnylpgeitdllqlariptlmafertyv
pyvavptqfddrplisfpitlsdpvyqntlvgaissnfanyrgciqitltfcgpmmargk
fllsysppngtqpqtlseamqctysiwdiglnsswtfvvpyispsdyretraitnsvysa
dgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf

SCOPe Domain Coordinates for d6admc_:

Click to download the PDB-style file with coordinates for d6admc_.
(The format of our PDB-style files is described here.)

Timeline for d6admc_: