Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (51 species) not a true protein |
Species Seneca valley virus [TaxId:390157] [188689] (3 PDB entries) |
Domain d6admc_: 6adm C: [364342] Other proteins in same PDB: d6admr1, d6admr2 automated match to d3cjib_ complexed with mg |
PDB Entry: 6adm (more details), 2.84 Å
SCOPe Domain Sequences for d6admc_:
Sequence, based on SEQRES records: (download)
>d6admc_ b.121.4.0 (C:) automated matches {Seneca valley virus [TaxId: 390157]} piptaprenslmflstlpddtvpaygnvrtppvnylpgeitdllqlariptlmafervpe pvpasdtyvpyvavptqfddrplisfpitlsdpvyqntlvgaissnfanyrgciqitltf cgpmmargkfllsysppngtqpqtlseamqctysiwdiglnsswtfvvpyispsdyretr aitnsvysadgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf
>d6admc_ b.121.4.0 (C:) automated matches {Seneca valley virus [TaxId: 390157]} piptaprenslmflstlpddtvpaygnvrtppvnylpgeitdllqlariptlmafertyv pyvavptqfddrplisfpitlsdpvyqntlvgaissnfanyrgciqitltfcgpmmargk fllsysppngtqpqtlseamqctysiwdiglnsswtfvvpyispsdyretraitnsvysa dgwfslhkltkitlppdcpqspcilffasagedytlrlpvdcnpsyvf
Timeline for d6admc_: