SCOPe 2.07: Domain d6af6a1: 6af6 A:1-230

Lineage for d6af6a1 (6af6 A:1-230)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (29 species)
   not a true protein

7. Species Serratia sp. [TaxId:104623] [357157] (5 PDB entries)

8. Domain d6af6a1: 6af6 A:1-230 [364338]
   Other proteins in same PDB: d6af6a2
   automated match to d3mpia1
   complexed with cl, fad, gly, o4b, pro

Details for d6af6a1

PDB Entry: 6af6, 1.62 Å

PDB Description: piga with fad and proline

PDB Compounds: (A:) L-prolyl-[peptidyl-carrier protein] dehydrogenase

SCOPe Domain Sequences for d6af6a1:

Sequence; same for both SEQRES and ATOM records:

>d6af6a1 e.6.1.0 (A:1-230) automated matches {Serratia sp. [TaxId: 104623]}
mdfnlsnsqsdiyesayrfacdvldqdaqtrisqkilstelwkkaaaygfahgpvshqfg
gselgaldtalmiealgkgsrdiglsfslcahlcacviplyrfgsselkdkyleslvtgk
liaanaatepdagsdiynmqataqpceggyilngkkifitnapiadvfiiyaktnpdhgf
lgvsafliekgtpglnvgevipkdclsncpwseivfndifipqsqrigme

Timeline for d6af6a1:

• d6af6a1 is new in SCOPe 2.07-stable
  
• d6af6a1 appears in the current release, SCOPe 2.08