Class b: All beta proteins [48724] (178 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) |
Protein automated matches [193245] (22 species) not a true protein |
Species Unidentified influenza virus [TaxId:11309] [364248] (1 PDB entry) |
Domain d6n4dd_: 6n4d D: [364272] automated match to d2bata_ complexed with bma, ca, man, nag |
PDB Entry: 6n4d (more details), 1.8 Å
SCOPe Domain Sequences for d6n4dd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n4dd_ b.68.1.1 (D:) automated matches {Unidentified influenza virus [TaxId: 11309]} leyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdhskcyqfalgqgttln nkhsnstihdrtshrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcvtgddrna tasfvyngmlvdsigswsrnilrtqesecvcingtctvvmtdgsasgradtrilfiregk iihisplsgsaqhieecscyprypnvrcvcrdnwkgsnrpvidinmadyninssyvcsgl vgdtprnddsssssnckdpnnergnpgvkgwafdndndvwmgrtiskdlrsgyetfkvig gwttansksqvnrqvivdnnnwsgysgifsvegkscvnrcfyvelirggpqetrvwwtsn sivvfcgtsgtygtgswpdganinfmpi
Timeline for d6n4dd_: