SCOPe 2.08: Domain d2heba_: 2heb A:

Lineage for d2heba_ (2heb A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (15 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (204 PDB entries)
   Uniprot P00695

8. Domain d2heba_: 2heb A: [36423]
   complexed with na

Details for d2heba_

PDB Entry: 2heb, 2.2 Å

PDB Description: contribution of water molecules in the interior of a protein to the conformational stability

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d2heba_:

Sequence; same for both SEQRES and ATOM records:

>d2heba_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgaslanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d2heba_:

• d2heba_ first appeared (with stable ids) in SCOP 1.55, called d2heb__
  
• d2heba_ appears in SCOPe 2.07