Lineage for d6j3wb_ (6j3w B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579367Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2579368Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2579369Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 2579432Protein automated matches [190549] (4 species)
    not a true protein
  7. 2579435Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (40 PDB entries)
  8. 2579497Domain d6j3wb_: 6j3w B: [364223]
    automated match to d3ng4a_
    complexed with 6na, act, edo, tla

Details for d6j3wb_

PDB Entry: 6j3w (more details), 2.07 Å

PDB Description: crystal structure of peptidoglycan recognition protein from camel with two specific tartrate binding sites at 2.07 a resolution.
PDB Compounds: (B:) Peptidoglycan recognition protein 1

SCOPe Domain Sequences for d6j3wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j3wb_ d.118.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
cgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyhvrnlg
wcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppralraaq
nllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

SCOPe Domain Coordinates for d6j3wb_:

Click to download the PDB-style file with coordinates for d6j3wb_.
(The format of our PDB-style files is described here.)

Timeline for d6j3wb_: