SCOPe 2.07: Domain d2ihla_: 2ihl A:

Lineage for d2ihla_ (2ihl A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (15 species)
   ubiquitous in a variety of tissues and secretions

7. Species Japanese quail (Coturnix coturnix japonica) [TaxId:93934] [53967] (1 PDB entry)

8. Domain d2ihla_: 2ihl A: [36408]
   complexed with na

Details for d2ihla_

PDB Entry: 2ihl, 1.4 Å

PDB Description: lysozyme (e.c.3.2.1.17) (japanese quail)

PDB Compounds: (A:) japanese quail egg white lysozyme

SCOPe Domain Sequences for d2ihla_:

Sequence; same for both SEQRES and ATOM records:

>d2ihla_ d.2.1.2 (A:) Lysozyme {Japanese quail (Coturnix coturnix japonica) [TaxId: 93934]}
kvygrcelaaamkrhgldkyqgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdvhgmnawvawrnrckgtdv
nawirgcrl

Timeline for d2ihla_:

• d2ihla_ first appeared (with stable ids) in SCOP 1.55, called d2ihl__
  
• d2ihla_ appears in SCOPe 2.06
  
• d2ihla_ appears in the current release, SCOPe 2.08