Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein Lysozyme [53961] (15 species) ubiquitous in a variety of tissues and secretions |
Species Japanese quail (Coturnix coturnix japonica) [TaxId:93934] [53967] (1 PDB entry) |
Domain d2ihla_: 2ihl A: [36408] complexed with na |
PDB Entry: 2ihl (more details), 1.4 Å
SCOPe Domain Sequences for d2ihla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ihla_ d.2.1.2 (A:) Lysozyme {Japanese quail (Coturnix coturnix japonica) [TaxId: 93934]} kvygrcelaaamkrhgldkyqgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdvhgmnawvawrnrckgtdv nawirgcrl
Timeline for d2ihla_: