Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d6huqa_: 6huq a: [363975] Other proteins in same PDB: d6huqe_, d6huqg_, d6huqi_, d6huqj_, d6huqk_, d6huql_, d6huqn_, d6huqo_, d6huqs_, d6huqu_, d6huqw_, d6huqx_, d6huqy_, d6huqz_ automated match to d4j70m_ complexed with cl, gt5, mg, so4 |
PDB Entry: 6huq (more details), 3 Å
SCOPe Domain Sequences for d6huqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6huqa_ d.153.1.4 (a:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakd
Timeline for d6huqa_: