Lineage for d6huqa_ (6huq a:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2601213Domain d6huqa_: 6huq a: [363975]
    Other proteins in same PDB: d6huqe_, d6huqg_, d6huqi_, d6huqj_, d6huqk_, d6huql_, d6huqn_, d6huqo_, d6huqs_, d6huqu_, d6huqw_, d6huqx_, d6huqy_, d6huqz_
    automated match to d4j70m_
    complexed with cl, gt5, mg, so4

Details for d6huqa_

PDB Entry: 6huq (more details), 3 Å

PDB Description: yeast 20s proteasome with human beta2c (s171g) in complex with 20
PDB Compounds: (a:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d6huqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6huqa_ d.153.1.4 (a:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakd

SCOPe Domain Coordinates for d6huqa_:

Click to download the PDB-style file with coordinates for d6huqa_.
(The format of our PDB-style files is described here.)

Timeline for d6huqa_: