| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
| Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
| Protein Lysozyme [53961] (15 species) ubiquitous in a variety of tissues and secretions |
| Species Chicken (Gallus gallus) [TaxId:9031] [53962] (908 PDB entries) Uniprot P00698 |
| Domain d2iffy_: 2iff Y: [36383] Other proteins in same PDB: d2iffh1, d2iffh2, d2iffl1, d2iffl2 mutant |
PDB Entry: 2iff (more details), 2.65 Å
SCOPe Domain Sequences for d2iffy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iffy_ d.2.1.2 (Y:) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
rwwcndgktpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl
Timeline for d2iffy_:
View in 3DDomains from other chains: (mouse over for more information) d2iffh1, d2iffh2, d2iffl1, d2iffl2 |