Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d6hwbp_: 6hwb P: [363806] Other proteins in same PDB: d6hwbe_, d6hwbg_, d6hwbi_, d6hwbj_, d6hwbk_, d6hwbl_, d6hwbn_, d6hwbo_, d6hwbs_, d6hwbu_, d6hwbw_, d6hwbx_, d6hwby_, d6hwbz_ automated match to d4cr2c_ complexed with cl, gwt, mes, mg |
PDB Entry: 6hwb (more details), 2.6 Å
SCOPe Domain Sequences for d6hwbp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hwbp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d6hwbp_: