SCOPe 2.07: Domain d6hw6c

Lineage for d6hw6c_ (6hw6 C:)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
N-terminal residue provides two catalytic groups, nucleophile and proton donor
Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
contains an extension to the common fold at the N-terminus

Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

Domain d6hw6c_: 6hw6 C: [363784]
Other proteins in same PDB: d6hw6a_, d6hw6h_, d6hw6i_, d6hw6j_, d6hw6k_, d6hw6l_, d6hw6m_, d6hw6n_, d6hw6v_, d6hw6w_, d6hw6x_, d6hw6y_, d6hw6z_
automated match to d4cr2d_
complexed with gt5, mg

Details for d6hw6c_

PDB Entry: 6hw6 (more details), 2.7 Å

PDB Description: yeast 20s proteasome in complex with 20

PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d6hw6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hw6c_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d6hw6c_:

Click to download the PDB-style file with coordinates for d6hw6c_.
(The format of our PDB-style files is described here.)

Timeline for d6hw6c_: