Lineage for d6hvsp_ (6hvs P:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2601248Domain d6hvsp_: 6hvs P: [363707]
    Other proteins in same PDB: d6hvsa_, d6hvse_, d6hvsg_, d6hvsi_, d6hvsj_, d6hvsk_, d6hvsl_, d6hvsn_, d6hvso_, d6hvss_, d6hvsu_, d6hvsw_, d6hvsx_, d6hvsy_, d6hvsz_
    automated match to d4cr2c_
    complexed with cl, grt, mg

Details for d6hvsp_

PDB Entry: 6hvs (more details), 3.1 Å

PDB Description: yeast 20s proteasome with human beta2i (1-53) in complex with 18
PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d6hvsp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hvsp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d6hvsp_:

Click to download the PDB-style file with coordinates for d6hvsp_.
(The format of our PDB-style files is described here.)

Timeline for d6hvsp_: