Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d6hv4u_: 6hv4 U: [363705] Other proteins in same PDB: d6hv4a_, d6hv4b_, d6hv4c_, d6hv4d_, d6hv4e_, d6hv4f_, d6hv4h_, d6hv4i_, d6hv4j_, d6hv4k_, d6hv4l_, d6hv4m_, d6hv4n_, d6hv4o_, d6hv4p_, d6hv4q_, d6hv4r_, d6hv4s_, d6hv4t_, d6hv4v_, d6hv4w_, d6hv4x_, d6hv4y_, d6hv4z_ automated match to d1irua_ complexed with cl, gqk, mes, mg, so4 |
PDB Entry: 6hv4 (more details), 3 Å
SCOPe Domain Sequences for d6hv4u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hv4u_ d.153.1.0 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae q
Timeline for d6hv4u_: