Lineage for d6hv4u_ (6hv4 U:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602194Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2602549Domain d6hv4u_: 6hv4 U: [363705]
    Other proteins in same PDB: d6hv4a_, d6hv4b_, d6hv4c_, d6hv4d_, d6hv4e_, d6hv4f_, d6hv4h_, d6hv4i_, d6hv4j_, d6hv4k_, d6hv4l_, d6hv4m_, d6hv4n_, d6hv4o_, d6hv4p_, d6hv4q_, d6hv4r_, d6hv4s_, d6hv4t_, d6hv4v_, d6hv4w_, d6hv4x_, d6hv4y_, d6hv4z_
    automated match to d1irua_
    complexed with cl, gqk, mes, mg, so4

Details for d6hv4u_

PDB Entry: 6hv4 (more details), 3 Å

PDB Description: yeast 20s proteasome with human beta2i (1-53) in complex with onx 0914
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d6hv4u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hv4u_ d.153.1.0 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d6hv4u_:

Click to download the PDB-style file with coordinates for d6hv4u_.
(The format of our PDB-style files is described here.)

Timeline for d6hv4u_: