Lineage for d6htry_ (6htr Y:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2597201Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2597210Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2598440Domain d6htry_: 6htr Y: [363398]
    Other proteins in same PDB: d6htra_, d6htrc_, d6htrd_, d6htre_, d6htrf_, d6htrg_, d6htrh_, d6htrm_, d6htro_, d6htrp_, d6htrq_, d6htrr_, d6htrs_, d6htrt_, d6htru_, d6htrv_
    automated match to d1g0uk_
    complexed with gqt, mg

Details for d6htry_

PDB Entry: 6htr (more details), 2.6 Å

PDB Description: yeast 20s proteasome with human beta2c (s171g) in complex with 13
PDB Compounds: (Y:) Proteasome subunit beta type-5

SCOPe Domain Sequences for d6htry_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6htry_ d.153.1.4 (Y:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

SCOPe Domain Coordinates for d6htry_:

Click to download the PDB-style file with coordinates for d6htry_.
(The format of our PDB-style files is described here.)

Timeline for d6htry_: