Lineage for d6htdr_ (6htd R:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2601211Domain d6htdr_: 6htd R: [363394]
    Other proteins in same PDB: d6htde_, d6htdg_, d6htdi_, d6htdj_, d6htdk_, d6htdl_, d6htdn_, d6htdo_, d6htds_, d6htdu_, d6htdw_, d6htdx_, d6htdy_, d6htdz_
    automated match to d1rype_
    complexed with cl, gqh, mg, so4

Details for d6htdr_

PDB Entry: 6htd (more details), 3 Å

PDB Description: yeast 20s proteasome with human beta2c (s171g) in complex with 4
PDB Compounds: (R:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d6htdr_:

Sequence, based on SEQRES records: (download)

>d6htdr_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d6htdr_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d6htdr_:

Click to download the PDB-style file with coordinates for d6htdr_.
(The format of our PDB-style files is described here.)

Timeline for d6htdr_: