Lineage for d6f9ja_ (6f9j A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2438501Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2439016Protein automated matches [190099] (33 species)
    not a true protein
  7. 2439038Species Barley (Hordeum vulgare) [TaxId:4513] [255684] (11 PDB entries)
  8. 2439044Domain d6f9ja_: 6f9j A: [363241]
    automated match to d1b1ya_
    complexed with cl, man, noj

Details for d6f9ja_

PDB Entry: 6f9j (more details), 1.67 Å

PDB Description: crystal structure of barley beta-amylase complexed with 4-o-alpha-d- mannopyranosyl-(1-deoxynojirimycin)
PDB Compounds: (A:) beta-amylase

SCOPe Domain Sequences for d6f9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f9ja_ c.1.8.1 (A:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
vkgnyvqvyvmlpldavsvnnrfekgdelraqlrklveagvdgvmvdvwwglvegkgpka
ydwsaykqlfelvqkaglklqaimsfhqcggnvgdavnipipqwvrdvgtrdpdifytdg
hgtrnieyltlgvdnqplfhgrsavqmyadymtsfrenmkefldagvivdievglgpage
mrypsypqshgwsfpgigeficydkylqadfkaaaaavghpewefpndvgqyndtpertq
ffrdngtylsekgrfflawysnnlikhgdrildeankvflgykvqlaikisgihwwykvp
shaaeltagyynlhdrdgyrtiarmlkrhrasinftcaemrdseqssqamsapeelvqqv
lsagwreglnvacenalprydptayntilrnarphginqsgppehklfgftylrlsnqlv
egqnyvnfktfvdrmhanlprdpyvdpmaplprsgpeisiemilqaaqpklqpfpfqeht
dlpvg

SCOPe Domain Coordinates for d6f9ja_:

Click to download the PDB-style file with coordinates for d6f9ja_.
(The format of our PDB-style files is described here.)

Timeline for d6f9ja_: