Lineage for d6f8hb_ (6f8h B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322501Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2322502Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2322951Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 2322952Protein automated matches [190907] (17 species)
    not a true protein
  7. 2323072Species Pseudomonas putida [TaxId:303] [354513] (2 PDB entries)
  8. 2323074Domain d6f8hb_: 6f8h B: [363207]
    automated match to d4mcxc_

Details for d6f8hb_

PDB Entry: 6f8h (more details), 2 Å

PDB Description: antitoxin graa
PDB Compounds: (B:) XRE family transcriptional regulator

SCOPe Domain Sequences for d6f8hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f8hb_ a.35.1.0 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
mrpihpgeilreefqkemgfsaaalaralgvatptvnnilrerggvsadmalrlsicldt
tpefwlnlqtafdlrtaeqqhgdeiigsvqrlva

SCOPe Domain Coordinates for d6f8hb_:

Click to download the PDB-style file with coordinates for d6f8hb_.
(The format of our PDB-style files is described here.)

Timeline for d6f8hb_: