Lineage for d6e90b2 (6e90 B:194-349)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2334748Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)
  8. 2334819Domain d6e90b2: 6e90 B:194-349 [363150]
    Other proteins in same PDB: d6e90a1, d6e90b1, d6e90c1, d6e90d1
    automated match to d1x0va2
    complexed with 13p, ca, mpd, nad, po4

Details for d6e90b2

PDB Entry: 6e90 (more details), 2.05 Å

PDB Description: ternary complex of human glycerol 3-phosphate dehydrogenase
PDB Compounds: (B:) Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic

SCOPe Domain Sequences for d6e90b2:

Sequence, based on SEQRES records: (download)

>d6e90b2 a.100.1.0 (B:194-349) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklfcsgpvssatfl
escgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpetarelysilqhk
glvdkfplfmavykvcyegqpvgefihclqnhpehm

Sequence, based on observed residues (ATOM records): (download)

>d6e90b2 a.100.1.0 (B:194-349) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklfcsgssatfles
cgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpetarelysilqhkgl
vdkfplfmavykvcyegqpvgefihclqnhpehm

SCOPe Domain Coordinates for d6e90b2:

Click to download the PDB-style file with coordinates for d6e90b2.
(The format of our PDB-style files is described here.)

Timeline for d6e90b2: