Lineage for d6e6if_ (6e6i F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442704Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 2442705Protein automated matches [190150] (34 species)
    not a true protein
  7. 2442906Species Sphingobium sp. [TaxId:627192] [339663] (5 PDB entries)
  8. 2442927Domain d6e6if_: 6e6i F: [363092]
    automated match to d5vn5a_
    complexed with hvs, zn

Details for d6e6if_

PDB Entry: 6e6i (more details), 2.4 Å

PDB Description: crystal structure of 4-methyl hopda bound to ligy from sphingobium sp. strain syk-6
PDB Compounds: (F:) 2,2',3-trihydroxy-3'-methoxy-5,5'-dicarboxybiphenyl meta-cleavage compound hydrolase

SCOPe Domain Sequences for d6e6if_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e6if_ c.1.9.0 (F:) automated matches {Sphingobium sp. [TaxId: 627192]}
miidchghvsapvelwaykasllahrgshgrggvkvtdeqiiaaahhketwpdghiellh
nhgtdmqlisprpfqmmnsakparvvhwfceevntlihrqctlipemfipvaglpqvage
pienvfaemdrcvsmgfkgfllnpdpyengaeeapplgdrywyplyeklceldlpahiha
tgsqserspyslhfineetiatynlctssvfddfpqlkvvvshgggaipyqlgrfesqsr
rskhlfsermaklyfdtvlytegalrllietvgperclfgsecpgvgstidpatgkqmdh
iapfiqkfdflsdadkklifednarkvfnle

SCOPe Domain Coordinates for d6e6if_:

Click to download the PDB-style file with coordinates for d6e6if_.
(The format of our PDB-style files is described here.)

Timeline for d6e6if_: