Lineage for d6c6aa1 (6c6a A:7-185)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507687Species Mouse (Mus musculus) [TaxId:10090] [224924] (65 PDB entries)
  8. 3062999Domain d6c6aa1: 6c6a A:7-185 [363061]
    Other proteins in same PDB: d6c6aa2, d6c6ab_
    automated match to d1zt4c2
    complexed with el7, nag

Details for d6c6aa1

PDB Entry: 6c6a (more details), 2.45 Å

PDB Description: structure of glycolipid agsa[16,6p] in complex with mouse cd1d
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6c6aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c6aa1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d6c6aa1:

Click to download the PDB-style file with coordinates for d6c6aa1.
(The format of our PDB-style files is described here.)

Timeline for d6c6aa1:

  • d6c6aa1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-05

View in 3D
Domains from same chain:
(mouse over for more information)
d6c6aa2
View in 3D
Domains from other chains:
(mouse over for more information)
d6c6ab_