SCOPe 2.07: Domain d6q8zd2: 6q8z D:217-392

Lineage for d6q8zd2 (6q8z D:217-392)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families)
common fold is elaborated with additional secondary structures
Family d.58.26.7: Galactokinase [103011] (2 proteins)
Protein automated matches [362873] (1 species)
not a true protein
Species Homo sapiens [TaxId:9606] [362874] (13 PDB entries)
Domain d6q8zd2: 6q8z D:217-392 [362969]
Other proteins in same PDB: d6q8za1, d6q8za3, d6q8zb1, d6q8zc1, d6q8zd1
automated match to d1wuua2
complexed with gal, hfk, hr5

Details for d6q8zd2

PDB Entry: 6q8z (more details), 2.4 Å

PDB Description: structure of human galactokinase 1 bound with n-(cyclobutylmethyl)-1, 5-dimethyl-1h-pyrazole-4-carboxamide

PDB Compounds: (D:) Galactokinase

SCOPe Domain Sequences for d6q8zd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q8zd2 d.58.26.7 (D:217-392) automated matches {Homo sapiens [TaxId: 9606]}
klavlitnsnvrhslasseypvrrrqceevaralgkeslrevqleeleaardlvskegfr
rarhvvgeirrtaqaaaalrrgdyrafgrlmveshrslrddyevscpeldqlveaalavp
gvygsrmtgggfggctvtlleasaaphamrhiqehyggtatfylsqaadgakvlcl

SCOPe Domain Coordinates for d6q8zd2:

Click to download the PDB-style file with coordinates for d6q8zd2.
(The format of our PDB-style files is described here.)

Timeline for d6q8zd2: